PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678472615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family bZIP
Protein Properties Length: 119aa    MW: 13659.8 Da    PI: 11.6796
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678472615genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.3e-141973256
               XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
               +++++ +r+++NReAArrsR+RKk++ + L +   +L   N  L+++l+     +
  678472615 19 CDDRKRKRMMSNREAARRSRLRKKQYADDLVNQLHTLRVNNGCLRDQLSVAMRDC 73
               68999****************************************9987666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-131882IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-111975No hitNo description
PROSITE profilePS5021710.0482083IPR004827Basic-leucine zipper domain
PfamPF001703.4E-112273IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.88E-122271No hitNo description
CDDcd147026.39E-122374No hitNo description
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MALEDMGNPP LQCRPPVSCD DRKRKRMMSN REAARRSRLR KKQYADDLVN QLHTLRVNNG  60
CLRDQLSVAM RDCRTAQLQS RQLLSDSIRL LHRLSTLRLF LHRTCAGPGQ ASNGTGFLR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13440RRSRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.12e-12basic leucine-zipper 2